Structure of PDB 1br8 Chain I Binding Site BS01

Receptor Information
>1br8 Chain I (length=404) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ICTAKPRDIPMNPMCIYRSPETNRRVWELSKANSRFATTFYQHLADSKND
NDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFF
FAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQP
LDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFK
GLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQVLEL
PFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPR
FRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAF
LEVNEEASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVA
NPCV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1br8 Implications for function and therapy of a 2.9 A structure of binary-complexed antithrombin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		F77 S82 A86 V190 R197 I198 L210 T211 V212 L213 V214 L215 V216 N217 T218 I219 Y220 F221 G223 F274 L362 Y363 V364 S365 D366 A367 F368 H369 K370 A371 F372 L373 E374
Binding residue
(residue number reindexed from 1)		F55 S60 A64 V168 R175 I176 L188 T189 V190 L191 V192 L193 V194 N195 T196 I197 Y198 F199 G201 F252 L340 Y341 V342 S343 D344 A345 F346 H347 K348 A349 F350 L351 E352
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005515 protein binding
GO:0008201 heparin binding
GO:0042802 identical protein binding
Biological Process
GO:0007596 blood coagulation
GO:0010466 negative regulation of peptidase activity
GO:0030193 regulation of blood coagulation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005788 endoplasmic reticulum lumen
GO:0005886 plasma membrane
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1br8, PDBe:1br8, PDBj:1br8
PDBsum1br8
PubMed9761669
UniProtP01008|ANT3_HUMAN Antithrombin-III (Gene Name=SERPINC1)

[Back to BioLiP]