Structure of PDB 4v8p Chain HX Binding Site BS01

Receptor Information

>4v8p Chain HX (length=188) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRKAAQEPKDDTLQMKVRQYVVSAARLPIEQGTKPEILQMRVFARDEVHA
KTKFWYNMRKLNKIKRSQGRILSVNEIYEKSLNTVKTYGIVLKYQSRTAI
HNMYKEYRDVSLNGAVSQLIQDMAGNHRAQPDTIQIIRTATLEPKDIKRP
ATLAMRNAALKFPIVKTIHRPSEKKYRTVYKATRPTTF

Ligand information

>4v8p Chain G3 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guugucggccauacuaaggugaaaacaccggaucccauucgaacuccgaa
guuaagcgccuuaaggcuggguuaguacuaaggugggggaccgcuuggga
agucccagugucgauagccu

<<<<<<<<.....<<<<<<<......<<<<<<............>>>>..
>>.....>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>.>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution	3.52 Å
Binding residue (original residue number in PDB)	T53 Y57 K61 K64 K66 S68 Q96 R98 Q131 D133
Binding residue (residue number reindexed from 1)	T52 Y56 K60 K63 K65 S67 Q95 R97 Q130 D132

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	P0DJ18\|RL18A_TETTH Large ribosomal subunit protein eL20 (Gene Name=RPL18A)

[Back to BioLiP]