Structure of PDB 6yft Chain HD Binding Site BS01

Receptor Information
>6yft Chain HD (length=113) Species: 1923567 (Wenzhou levi-like virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STFSSLVIGSNTFIPTAPGYYSLSTRGFSDPRNQIKISGGKFNAKTGRVT
AAVSRLWETDVTVAGLPVRSAAEVAIIMTLGRGITATNADVLLSDLNTLL
DPARLDQILQGGF
Ligand information
>6yft Chain SF (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auauauauauuauauauaua
<<<<<<<<<.>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yft Three-dimensional structure of 22 uncultured ssRNA bacteriophages: Flexibility of the coat protein fold and variations in particle shapes.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y20 K36 S38 K41 N43 T50 A52 E73
Binding residue
(residue number reindexed from 1)
Y20 K36 S38 K41 N43 T50 A52 E73
External links