Structure of PDB 4v8p Chain HB Binding Site BS01

Receptor Information
>4v8p Chain HB (length=51) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GANKTLNMKKRFGRKIKQNRPLPNWYRYKSDTNIRYNSKRRNWRRTKLKI
Y
Ligand information
>4v8p Chain G2 (length=154) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaaaauuuucaacgguggauaucuagguucccgugacgaugaagaacgc
agcgaaaugcgauacgcaaugcgaauugcagaaccgcgagucaucagauc
uuugaacgcaagugguggagguguaaaaaccuucauguuuguuucagugu
ggaa
............................................<<<<<<
.<<.....>>>.....(.<<<......>>............>>>..)...
>>>....<<.....>><<<<<<......>>>>>>................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution3.52 Å
Binding residue
(original residue number in PDB)		T6 L7 K11 R12 R15 K18 Q19 R21 L23 W26 Y27 Y29 K30 S31 K40 Y52
Binding residue
(residue number reindexed from 1)		T5 L6 K10 R11 R14 K17 Q18 R20 L22 W25 Y26 Y28 K29 S30 K39 Y51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtP0DJ61|RL39_TETTS Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]