Structure of PDB 9fh9 Chain H Binding Site BS01

Receptor Information

>9fh9 Chain H (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA

Ligand information

>9fh9 Chain K (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MALR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9fh9 Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	E102 H106 E110
Binding residue (residue number reindexed from 1)	E73 H77 E81

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:9fh9, PDBe:9fh9, PDBj:9fh9
PDBsum	9fh9
PubMed	39143240
UniProt	P02281\|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]