Structure of PDB 9fgq Chain H Binding Site BS01

Receptor Information
>9fgq Chain H (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fgq Spatial control of the APC/C ensures the rapid degradation of Cyclin B1
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q44 H106
Binding residue
(residue number reindexed from 1)		Q15 H77
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fgq, PDBe:9fgq, PDBj:9fgq
PDBsum9fgq
PubMed39143240
UniProtP33778|H2B1B_HUMAN Histone H2B type 1-B (Gene Name=H2BC3)

[Back to BioLiP]