Structure of PDB 9c4c Chain H Binding Site BS01

Receptor Information
>9c4c Chain H (length=136) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYL
IYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIE
HHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c4c The structure of two MntR dimers bound to the native mnep promoter sequence.
Resolution3.09 Å
Binding residue
(original residue number in PDB)
Y22 R24 Y54 K56
Binding residue
(residue number reindexed from 1)
Y20 R22 Y52 K54
External links
PDB RCSB:9c4c, PDBe:9c4c, PDBj:9c4c
PDBsum9c4c
PubMed
UniProtP54512|MNTR_BACSU HTH-type transcriptional regulator MntR (Gene Name=mntR)

[Back to BioLiP]