Structure of PDB 9b8o Chain H Binding Site BS01

Receptor Information
>9b8o Chain H (length=57) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIEGTDSYELTGLARGGEQLA
KLKRNYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b8o High-resolution electron cryomicroscopy of V-ATPase in native synaptic vesicles.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V87 K89 A90
Binding residue
(residue number reindexed from 1)		V24 K26 A27
Gene Ontology
Biological Process
GO:0006811 monoatomic ion transport
GO:0030030 cell projection organization
GO:0060271 cilium assembly
GO:0061512 protein localization to cilium
GO:0097401 synaptic vesicle lumen acidification
Cellular Component
GO:0005654 nucleoplasm
GO:0005813 centrosome
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane
GO:0030665 clathrin-coated vesicle membrane
GO:0033176 proton-transporting V-type ATPase complex
GO:0098850 extrinsic component of synaptic vesicle membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9b8o, PDBe:9b8o, PDBj:9b8o
PDBsum9b8o
PubMed38900912
UniProtQ6P503

[Back to BioLiP]