Structure of PDB 9aur Chain H Binding Site BS01

Receptor Information
>9aur Chain H (length=228) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EISEVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEW
VASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCA
RQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>9aur Chain R (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugaaacacgaccugagaaa
<<<<.......>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9aur A potential role for RNA aminoacylation prior to its role in peptide synthesis.
Resolution1.57 Å
Binding residue
(original residue number in PDB)		Y34 P56 Y57 S58 S60 Y62 Q102 Y104 R105 R106 R110
Binding residue
(residue number reindexed from 1)		Y34 P56 Y57 S58 S60 Y62 Q102 Y104 R105 R106 R110
External links