Structure of PDB 9ash Chain H Binding Site BS01

Receptor Information
>9ash Chain H (length=214) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLVIEGTIVLKTGMHIGGSSDFSAIGAVDSPVVRDTLTRLPLIPGSSLK
GKMRYLLAKELNNGILLNEPNNDQDEILRLFGSSEKDKIRRARLKFNDIK
LSNLAELETFNVSSTEVKFENTINRKTAVANPRQIERVIAGSKFDFEIFY
NLDDIKEVEKDFENIKQGFDLLEFDYLGGHGTRGSGRIAFENLSVITAVG
NFEKINTLNEILGA
Ligand information
>9ash Chain R (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacgcagcaccagcuguccaaccugaagaaga
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9ash Molecular basis for cA6 synthesis by a type III-A CRISPR-Cas enzyme and its conversion to cA4 production.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		G18 S47 S48 K50 G51 K52 R54 S84 E120 N121 T122 I123 R133 Y176 G178 G179 T182 R183
Binding residue
(residue number reindexed from 1)		G18 S47 S48 K50 G51 K52 R54 S84 E120 N121 T122 I123 R133 Y176 G178 G179 T182 R183
External links