Structure of PDB 8y6u Chain H Binding Site BS01

Receptor Information
>8y6u Chain H (length=92) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGL
KLFRRRNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQARSA
Ligand information
>8y6u Chain 1 (length=68) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagccattataaattgtccgttgagcttctaccagcaaatacctataatg
ggagctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y6u NMR analysis of a loop-bulge structure of UUCGA pentaloop.
Resolution3.97 Å
Binding residue
(original residue number in PDB)		F23 S38 H39 R58
Binding residue
(residue number reindexed from 1)		F23 S38 H39 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0009411 response to UV
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6u, PDBe:8y6u, PDBj:8y6u
PDBsum8y6u
PubMed38039839
UniProtP0A9F6|GCVA_ECOLI Glycine cleavage system transcriptional activator (Gene Name=gcvA)

[Back to BioLiP]