Structure of PDB 8xop Chain H Binding Site BS01

Receptor Information

>8xop Chain H (length=176) Species: 67305 (Streptomyces hawaiiensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YDPYAKLFEERVIFLGVQIDDASANDVMAQLLCLESMDPDRDISVYINSP
GGSFTALTAIYDTMQYVKPDVQTVCMGQAAAAAAVLLAAGTPGKRMALPN
ARVLIHQPYSETGRGQVSDLEIAANEILRMRSQLEDMLAKHSTTPVEKIR
EDIERDKILTAEDALSYGLIDQVIST

Ligand information

>8xop Chain V (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tFSPAAK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8xop Structural insights into the Clp protein degradation machinery.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	L57 E60 Y96
Binding residue (residue number reindexed from 1)	L7 E10 Y46

Enzymatic activity

Enzyme Commision number

3.4.21.92: endopeptidase Clp.

Gene Ontology

	Molecular Function
GO:0004176	ATP-dependent peptidase activity
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8xop, PDBe:8xop, PDBj:8xop
PDBsum	8xop
PubMed	38501868
UniProt	A0A5B9BIX9

[Back to BioLiP]