Structure of PDB 8vis Chain H Binding Site BS01

Receptor Information
>8vis Chain H (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPR
DWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTK
DIHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDV
CNAPHSYNGAILSGMLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGI
VSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGIE
Ligand information
>8vis Chain E (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWLINECGAGPDLITDDDDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vis Human TMPRSS11D complexed with a disulfide-linked autoinhibitory DDDDK peptide
Resolution1.59 Å
Binding residue
(original residue number in PDB)		H227 H269 Y316 A363 C364 Q365 G366 S368 V387 S388 W389 G390
Binding residue
(residue number reindexed from 1)		H41 H83 Y130 A177 C178 Q179 G180 S182 V201 S202 W203 G204
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8vis, PDBe:8vis, PDBj:8vis
PDBsum8vis
PubMed
UniProtO60235|TM11D_HUMAN Transmembrane protease serine 11D (Gene Name=TMPRSS11D)

[Back to BioLiP]