Structure of PDB 8vdu Chain H Binding Site BS01

Receptor Information
>8vdu Chain H (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
LGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTIS
PSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGD
WTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vdu A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F11 Y30 A57 Y60 W61 E74 H81 N82
Binding residue
(residue number reindexed from 1)		F9 Y28 A55 Y58 W59 E72 H79 N80
External links