Structure of PDB 8rkg Chain H Binding Site BS01

Receptor Information
>8rkg Chain H (length=164) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFNL
ENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNSTHATVLIPFFGG
VLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRGDRNDVLVLTFI
YYGKTVPMLISLVC
Ligand information
>8rkg Chain R (length=25) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVVTCTKDSMTVRIPRTLSGFDDEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
F166 W167 M182 R186 F192 S193 S194 L199
Binding residue
(residue number reindexed from 1)
F1 W2 M17 R21 F27 S28 S29 L34
Enzymatic activity
Enzyme Commision number ?
External links