Structure of PDB 8rg0 Chain H Binding Site BS01

Receptor Information
>8rg0 Chain H (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCST
VLCQPTGGKARLTEGCSFRRK
Ligand information
>8rg0 Chain A (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacggccgggggcauucgcggaccagagcggcauuugccaagaauguuu
ugcgaugcggcggcguugacccgccgggcagcuaaggguggugauggcgu
ucagccaguccuuuaucauua
.<<<<..<...<<<<..<..>.......<<.>>...>>>>..>..>>>.>
.<<..<.<<<<<<.<<..>>>>>>>>.>..>>.<<..........<<<..
...>>>.....>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R17 H19 K20 K22 P28 S30 H49 Q51 P66 T67 G68 G69 K70
Binding residue
(residue number reindexed from 1)		R6 H8 K9 K11 P17 S19 H38 Q40 P55 T56 G57 G58 K59
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtP42677|RS27_HUMAN Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]