Structure of PDB 8pkj Chain H Binding Site BS01

Receptor Information
>8pkj Chain H (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>8pkj Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtattggccttgaacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pkj Nucleosome-bound NR5A2 structure reveals pioneer factor mechanism by DNA minor groove anchor competition.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y42 I54 S55 S56 S87 T88
Binding residue
(residue number reindexed from 1)		Y8 I20 S21 S22 S53 T54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8pkj, PDBe:8pkj, PDBj:8pkj
PDBsum8pkj
PubMed38409506
UniProtQ6ZWY9|H2B1C_MOUSE Histone H2B type 1-C/E/G (Gene Name=H2bc4)

[Back to BioLiP]