Structure of PDB 8pki Chain H Binding Site BS01

Receptor Information
>8pki Chain H (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>8pki Chain I (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgttcaaggccaat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pki Nucleosome-bound NR5A2 structure reveals pioneer factor mechanism by DNA minor groove anchor competition.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		E35 S36 Y40
Binding residue
(residue number reindexed from 1)		E1 S2 Y6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8pki, PDBe:8pki, PDBj:8pki
PDBsum8pki
PubMed38409506
UniProtQ6ZWY9|H2B1C_MOUSE Histone H2B type 1-C/E/G (Gene Name=H2bc4)

[Back to BioLiP]