Structure of PDB 8onk Chain H Binding Site BS01

Receptor Information
>8onk Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVRLQQSGPELVKPGASLKISCKASGYTFTDYNIHWLRQSHSKSLEWIGS
IYPYNGRPGYNQKFKNKTTLTVDNSSSTAYMELRGLTSDDSAVYFCARSR
SYYNGSRDYWGQGTSLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPV
TVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHP
ASSTKVDKKIVPRD
Ligand information
>8onk Chain B (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8onk Macromolecular structure of insulin and IgE clonality impacts IgE-mediated activation of sensitized basophils
Resolution3.403 Å
Binding residue
(original residue number in PDB)		N33 Y52 G59 Y60 S99 R100 S101 Y102
Binding residue
(residue number reindexed from 1)		N33 Y52 G59 Y60 S99 R100 S101 Y102
External links