Structure of PDB 8oej Chain H Binding Site BS01

Receptor Information
>8oej Chain H (length=178) Species: 29292 (Pyrococcus abyssi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMPATRLYIKDILEGYFVKSEGDFEPNYLITKYARKVYRAKIVGTVVRE
PLIAEDETYGKFQVDDGTGVIWVLGFRDDTKFAKLVRKGDLVQVIGKIAE
WRDDKQILVEGVSKVHPNMWILHRYETLKEKIEHIKKAKIALEIYNQYGI
TAKSKVIAKNKGIEEELLEVIDELYGIM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oej DNA-binding mechanism and evolution of replication protein A.
Resolution8.0 Å
Binding residue
(original residue number in PDB)
K3 R4 K22 D26 F27 E28 P29 R42 Y61 L76 F78 R79 K99 W103 Q108
Binding residue
(residue number reindexed from 1)
K1 R2 K20 D24 F25 E26 P27 R40 Y59 L74 F76 R77 K97 W101 Q106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:8oej, PDBe:8oej, PDBj:8oej
PDBsum8oej
PubMed37087464
UniProtQ9V1Z1

[Back to BioLiP]