Structure of PDB 8kbc Chain H Binding Site BS01

Receptor Information
>8kbc Chain H (length=129) Species: 1392497 (Clostridioides mangenotii LM2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGLVPRGSHMEIKNGLCTQKYTKVYAEDKEKWKFNAPHHFIVGKADCED
EYIEPIEYVNFQEGPIKEYGINGVNNEDLILMVITRLQAFQDSPYKCREN
AMAITKLQECLMWLGKRTLDREVKGIEGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kbc Structure of CmTad1 complexed with cAAA
Resolution2.8 Å
Binding residue
(original residue number in PDB)
K86 C87 R88 A91 M92 T95
Binding residue
(residue number reindexed from 1)
K96 C97 R98 A101 M102 T105
External links
PDB RCSB:8kbc, PDBe:8kbc, PDBj:8kbc
PDBsum8kbc
PubMed
UniProtP0DW61|TAD1_CLOM2 Thoeris anti-defense 1 (Gene Name=tad1)

[Back to BioLiP]