Structure of PDB 8jkq Chain H Binding Site BS01

Receptor Information

>8jkq Chain H (length=109) Species: 9606 (Homo sapiens)

GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALF
KAWALFKGKFREGIDKPDPPTWKRRLRCALNKSNDFEELVERSQLDISDP
YKVYRIVPE

Ligand information

>8jkq Chain C (length=19)

caactgacaccgagaaacc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jkq Molecular basis for the functional roles of the multimorphic T95R mutation of IRF4 causing human autosomal dominant combined immunodeficiency.
• Resolution: 3.09 Å
• Binding residue (original residue number in PDB): W54 H56 A57 K94 K103
• Binding residue (residue number reindexed from 1): W33 H35 A36 K73 K82

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:8jkq, PDBe:8jkq, PDBj:8jkq
• PDBsum: 8jkq
• PubMed: 37683642
• UniProt: F2Z3D5