Structure of PDB 8i17 Chain H Binding Site BS01

Receptor Information
>8i17 Chain H (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i17 Structural basis for H2A-H2B recognitions by human Spt16.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		Y42 I54 S55 S56 K57
Binding residue
(residue number reindexed from 1)		Y9 I21 S22 S23 K24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8i17, PDBe:8i17, PDBj:8i17
PDBsum8i17
PubMed36801613
UniProtP06899|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)

[Back to BioLiP]