Structure of PDB 8hr1 Chain H Binding Site BS01

Receptor Information
>8hr1 Chain H (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>8hr1 Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hr1 A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		Y42 I54 S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)		Y9 I21 S22 S23 R53 S54 T55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hr1, PDBe:8hr1, PDBj:8hr1
PDBsum8hr1
PubMed38177667
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]