Structure of PDB 8h2u Chain H Binding Site BS01

Receptor Information
>8h2u Chain H (length=90) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRYFDLQDMENTTGSWDMYGVDEKKRYPDNQAKFFTQATDIISRRESLRA
LVALSGIAAIVTYGLKAKDADLPITKGPQTTGENGKGGSV
Ligand information
>8h2u Chain I (length=29) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SWAPSVFVPLTGLVLPAIAMATLFVYIEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h2u Three structures of PSI-LHCI from Chlamydomonas reinhardtii suggest a resting state re-activated by ferredoxin.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I92 L100
Binding residue
(residue number reindexed from 1)		I57 L65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h2u, PDBe:8h2u, PDBj:8h2u
PDBsum8h2u
PubMed37270022
UniProtP13352|PSAH_CHLRE Photosystem I reaction center subunit VI, chloroplastic (Gene Name=PSAH)

[Back to BioLiP]