Structure of PDB 8gvb Chain H Binding Site BS01

Receptor Information
>8gvb Chain H (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPW
IEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGC
DVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAH
VAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gvb Molecular Basis for the Recognition of HIV Nef138-8 Epitope by a Pair of Human Public T Cell Receptors.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 T73 N77 I80 F99 Y116 Y123 T143 K146 W147 V152 Q155 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y6 E62 K65 V66 H69 T72 N76 I79 F98 Y115 Y122 T142 K145 W146 V151 Q154 Y158 Y170
Enzymatic activity
Enzyme Commision number ?
External links