Structure of PDB 8gho Chain H Binding Site BS01

Receptor Information
>8gho Chain H (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWIGE
IKPSNELTNVHEKFKDRFTISVDKAKNSAYLQMNSLRAEDTAVYYCTRTI
TTTEGYWFFDVWGQGTLVTVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gho Molecular insights into recognition of GUCY2C by T-cell engaging bispecific antibody anti-GUCY2CxCD3.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		W33 E50 K52 T58 N59 E104 W107
Binding residue
(residue number reindexed from 1)		W33 E50 K52 T58 N59 E104 W107
External links