Structure of PDB 8g8c Chain H Binding Site BS01

Receptor Information
>8g8c Chain H (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGSELKKPGASVNISCKASGYNFTSHALNWVRQAPGQGLDWLGW
INTNTGNPTYAQGFTGRFVFSLDTSVGSAYLQISSLKAEDSAVYFCARVR
FHGSGSFPQPADFYYYMDVWGKGTTVTVSSASTKGPSVFPLAPSSGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEP
Ligand information
>8g8c Chain C (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNEQELLELDKWASLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8c Vaccine induction of heterologous HIV-1 neutralizing antibody B cell lineages in humans
Resolution2.08 Å
Binding residue
(original residue number in PDB)		T30 S31 H32 A33 W50 N52 T52A N53 T58 R96 F97 F100C Y100K
Binding residue
(residue number reindexed from 1)		T30 S31 H32 A33 W50 N52 T53 N54 T59 R100 F101 F107 Y115
External links