Structure of PDB 8g2m Chain H Binding Site BS01

Receptor Information
>8g2m Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTNYFMNWVRQAPGQGLEWMGR
VDPEQGRADYAEKFKKRVTITADKSTSTAYMELSSLRSEDTAVYYCARRA
MDNYGFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSAGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKA
Ligand information
>8g2m Chain F (length=9) Species: 160651 (Peptide display vector fth1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CPFPALELC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g2m XTX101, a tumor-activated, Fc-enhanced anti-CTLA-4 monoclonal antibody, demonstrates tumor-growth inhibition and tumor-selective pharmacodynamics in mouse models of cancer.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F33 R50 D52 D59 R99 Y104
Binding residue
(residue number reindexed from 1)		F33 R50 D52 D59 R99 Y104
External links