Structure of PDB 8fb8 Chain H Binding Site BS01

Receptor Information
>8fb8 Chain H (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNSGMHWVRQVPGKGLEWVAI
IWYDGSNKYYADSVKGRFSVSRDNSENTLYLQMSNLRAEDTAVYYCVRAY
FDSENLYDKYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEP
Ligand information
>8fb8 Chain P (length=8) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PDPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fb8 Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution1.69 Å
Binding residue
(original residue number in PDB)		N31 S32 G33 W52 Y52A Y58 K100E Y100F
Binding residue
(residue number reindexed from 1)		N31 S32 G33 W52 Y53 Y59 K109 Y110
External links