Structure of PDB 8fa6 Chain H Binding Site BS01

Receptor Information
>8fa6 Chain H (length=228) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNSGMHWVRQVPGKGLEWVAI
IWYDGSNKYYADSVKGRFSVSRDNSENTLYLQMSNLRAEDTAVYYCVRAY
FDSENLYDYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>8fa6 Chain P (length=9) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VDPNANPNV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fa6 Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.6 Å
Binding residue
(original residue number in PDB)		N31 S32 G33 W52 Y52A Y58 Y100E Y100F
Binding residue
(residue number reindexed from 1)		N31 S32 G33 W52 Y53 Y59 Y109 Y110
External links