Structure of PDB 8f9e Chain H Binding Site BS01

Receptor Information
>8f9e Chain H (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLLVESGGGVVQPGTSLRLSCVASGFSFSTYGMHWVRQSPGKGLEWVAI
IWYDGGNKFYADSVQGRFTVSRDNSKNTLYLQMNSLRAEDTAVYYCAKAY
RTSLDKKYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>8f9e Chain P (length=11) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DGNPDPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f9e Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.95 Å
Binding residue
(original residue number in PDB)		T31 Y32 G33 W52 Y52A F58 A95 T98 K100B K100C Y100D
Binding residue
(residue number reindexed from 1)		T31 Y32 G33 W52 Y53 F59 A99 T102 K106 K107 Y108
External links