Structure of PDB 8eli Chain H Binding Site BS01

Receptor Information
>8eli Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKVLVQSGAEVKKPGASVKVSCRAFGYTFTGNALHWVRQAPGQGLEWLGW
INPHSGDTFTSQKFQGRVYMTRDKSINTAFLDVTRLTSDDTGIYYCARDK
YYGNEAVGMDVWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eli Structural mechanism for broad HIV-1 fusion peptide neutralization revealed by directed antibody evolution
Resolution1.49 Å
Binding residue
(original residue number in PDB)		T30 W50 N52 H53 Y97 N100 E100A A100B
Binding residue
(residue number reindexed from 1)		T30 W50 N52 H54 Y101 N104 E105 A106
External links