Structure of PDB 8eh5 Chain H Binding Site BS01

Receptor Information
>8eh5 Chain H (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVKLVESGGGVVQPGRSLRLSCEASGFIFSTYGMHWVRQAPGKGLEWVAV
IWFDGSNIYYADSVKGRFTISRDNSKNTVFMQMDSLRAEDTAVYYCHRNF
YDGSGPFDYWGQGTLVTVS
Ligand information
>8eh5 Chain G (length=26) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NANPNVDPNANPNVDPNANPNVDPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eh5 Structural basis of epitope selectivity and potent protection from malaria by PfCSP antibody L9.
Resolution3.36 Å
Binding residue
(original residue number in PDB)
Y32 W52 F96 Y97 D98
Binding residue
(residue number reindexed from 1)
Y32 W52 F100 Y101 D102
External links