Structure of PDB 8dy7 Chain H Binding Site BS01

Receptor Information
>8dy7 Chain H (length=85) Species: 54571 (Streptomyces venezuelae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTELFQELLVEDADEELGWQERALCAQTDPESFFPEKGGSTREAKKVCLA
CEVRSECLEYALQNDERFGIWGGLSERERRRLKKK
Ligand information
>8dy7 Chain P (length=71) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggccgctgctgctcaagaggggttcgcgggacggcatcggccaattggc
ccggtgtgtcgcacgatctgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dy7 Structural basis of dual activation of cell division by the actinobacterial transcription factors WhiA and WhiB.
Resolution3.18 Å
Binding residue
(original residue number in PDB)		K37 G38 R42
Binding residue
(residue number reindexed from 1)		K37 G38 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dy7, PDBe:8dy7, PDBj:8dy7
PDBsum8dy7
PubMed36888660
UniProtF2R611

[Back to BioLiP]