Structure of PDB 8d36 Chain H Binding Site BS01

Receptor Information
>8d36 Chain H (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMQLMQSGAEVKKPGASVTVSCKASGDTFSDYRIHWVRQAPGQGLEWMGR
MNPKSGDTNFAQKFQGRVTMTRDMSINTAYMTLSGLTFDDTALYYCASLL
IVGGFDPLDDFEVWGQGTMVTISSASTKGPSVFPLAPGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPK
Ligand information
>8d36 Chain F (length=14) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSKRSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d36 Broadly neutralizing antibodies target the coronavirus fusion peptide.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		D31 R33 H35 R50 T58 N59 L99 V102 G104 F105 D109
Binding residue
(residue number reindexed from 1)		D31 R33 H35 R50 T58 N59 L99 V102 G104 F105 D109
External links