Structure of PDB 8bzm Chain H Binding Site BS01

Receptor Information
>8bzm Chain H (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKN
KPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bzm FOXK1-ELF1_heterodimer bound to DNA
Resolution2.69 Å
Binding residue
(original residue number in PDB)		Y209 W250 K254 K256 R266 Y270 Y271 R274
Binding residue
(residue number reindexed from 1)		Y4 W45 K49 K51 R61 Y65 Y66 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bzm, PDBe:8bzm, PDBj:8bzm
PDBsum8bzm
PubMed
UniProtP32519|ELF1_HUMAN ETS-related transcription factor Elf-1 (Gene Name=ELF1)

[Back to BioLiP]