Structure of PDB 8bbh Chain H Binding Site BS01

Receptor Information
>8bbh Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTTYALNWVKQAPGKGLKWMGW
INTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNADTATYFCARGM
SGTFDYWGQGTSLTVSSAKTTPPSVYPLAPGCTGSSVTLGCLVKGYFPES
VTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAH
PASSTTVDKKIEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bbh Pathogenic antibody response to glucose-6-phosphate isomerase targets a modified epitope uniquely exposed on joint cartilage.
Resolution1.619 Å
Binding residue
(original residue number in PDB)		T30 T31 Y32 A33 N35 N52 T53 Y54 G102
Binding residue
(residue number reindexed from 1)		T30 T31 Y32 A33 N35 N52 T53 Y54 G102
External links