Structure of PDB 8axh Chain H Binding Site BS01

Receptor Information
>8axh Chain H (length=227) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAE
IRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTG
VGQFAYWGQGTTVTVSSDIVVTQESALTTSPGETVTLTCRSSTGAVTTSN
YANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTE
DEAIYFCALWYSNHWVFGGGTKLTVLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8axh Crystal structure of a MUC1-like glycopeptide containing the unnatural L-4-hydroxynorvaline in complex with scFv-SM3
Resolution1.85 Å
Binding residue
(original residue number in PDB)		N31 Y32 W33 Q97 Y1032 W1091 W1096
Binding residue
(residue number reindexed from 1)		N31 Y32 W33 Q103 Y151 W210 W215
External links