Structure of PDB 7z50 Chain H Binding Site BS01

Receptor Information

>7z50 Chain H (length=186) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVEQLPSILRVQEGSSASINCSYEDSASNYFPWYKQEPGENPKLIIDIRS
NMERKQTQGLIVLLDKKAKRFSLHITDTQPGDSAMYFCAASVRNYKYVFG
AGTRLKVIADIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSKDSDVY
ITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN

Ligand information

>7z50 Chain T (length=13) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LQTLALEVEDDPC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z50 Structural plasticity in I-A g7 links autoreactivity to hybrid insulin peptides in type I diabetes.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	V95 R96 N97
Binding residue (residue number reindexed from 1)	V92 R93 N94

External links

PDB	RCSB:7z50, PDBe:7z50, PDBj:7z50
PDBsum	7z50
PubMed	35967292

[Back to BioLiP]