Structure of PDB 7y8j Chain H Binding Site BS01

Receptor Information
>7y8j Chain H (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGSELKKPGASVRISCKASGYSFTSLSMNWVRQAPGQGLEWMGW
ISTKSGDPTYAQAFTGRFVFSLDTSVNTAYLQINSLEAGDTAVYYCARGQ
PPVGWTFDYWGQGTLVTVSSGG
Ligand information
>7y8j Chain A (length=6) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVVNQN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y8j Cross-reactive epitopes between HIV and Coronavirus revealed by 3D1
Resolution1.03 Å
Binding residue
(original residue number in PDB)		T30 S31 L32 S33 N35 W50 S52 T53 P102 V103 G104 W105
Binding residue
(residue number reindexed from 1)		T30 S31 L32 S33 N35 W50 S52 T53 P102 V103 G104 W105
External links