Structure of PDB 7y3j Chain H Binding Site BS01

Receptor Information
>7y3j Chain H (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPELVKPGASVKIFCKASGYTFTDYNMDWVKQSHGKRLEWIGD
INPNTGVTIDNPKFKGKATLTVDESSSTVYMELRSLSSEDTAVYYCARLP
DNYVMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTC
NVAHPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3j Structural basis of the 24B3 antibody against the toxic conformer of amyloid beta with a turn at positions 22 and 23.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T30 N33 N52 N54 I59 L99 Y103
Binding residue
(residue number reindexed from 1)		T30 N33 N52 N54 I59 L99 Y103
External links