Structure of PDB 7xuz Chain H Binding Site BS01

Receptor Information
>7xuz Chain H (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xuz Structural insights into transcription regulation by the higher-order HDAC4-MEF2-DNA complex
Resolution3.591 Å
Binding residue
(original residue number in PDB)		G2 R3 T20 K23 R24 K30
Binding residue
(residue number reindexed from 1)		G1 R2 T19 K22 R23 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xuz, PDBe:7xuz, PDBj:7xuz
PDBsum7xuz
PubMed38281192
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]