Structure of PDB 7uy5 Chain H Binding Site BS01

Receptor Information
>7uy5 Chain H (length=199) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELDIKESLKLQMEYYFCDTNLTHDSYLRGIISKSPKNCVDIKVFLKFNKI
QQILKSKKDLIHLIRDSLKESKILKVKMDSLKVKRRFPFNLNCLIKIINI
PQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRLAIQKLLNHN
NNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKFFFMKKQQK
Ligand information
>7uy5 Chain B (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccgcuuaauucauucagaucuguaauagaacugucauucaaccccaaaa
aucuagugcugauauaaccuucaccaauuagguucaaauaagugguaaug
cgggacaaaagacuaucgacauuugauacacuauuuaucaauggaugucu
uauuuu
<<<<<..........<<<.<<<<...>>>>.>>>................
...............<<<<<..((((.((>>>>>.....)).))))...>
>>>>..<..<<<<.<<<...<.<<<<<<.......>>>>>>>.>>>>>>>
>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uy5 Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H137 S139 Y140 V157 F161 N162 K163 K221 V222 K228 V229 K230 K392 A393 R400 F406 Y407 R465 I514 K518 F521 R522 F525 K528
Binding residue
(residue number reindexed from 1)		H23 S25 Y26 V43 F47 N48 K49 K75 V76 K82 V83 K84 K106 A107 R114 F120 Y121 R132 I181 K185 F188 R189 F192 K195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0070034 telomerase RNA binding
Biological Process
GO:0007004 telomere maintenance via telomerase
GO:0090669 telomerase RNA stabilization
GO:1904868 telomerase catalytic core complex assembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uy5, PDBe:7uy5, PDBj:7uy5
PDBsum7uy5
PubMed35831498
UniProtW7X6T2|LARP7_TETTS La-related protein 7 homolog (Gene Name=TAP65)

[Back to BioLiP]