Structure of PDB 7ufq Chain H Binding Site BS01

Receptor Information
>7ufq Chain H (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVHLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
IKGGNGNTRYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAVYYCALLT
VITKDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEP
Ligand information
>7ufq Chain A (length=13) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ufq Structure of PfCSP peptide 21 with antibody P3-43
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y32 A33 H35 W50 R58 L95 T96 V97 I98 K100
Binding residue
(residue number reindexed from 1)		Y32 A33 H35 W50 R59 L99 T100 V101 I102 K104
External links