Structure of PDB 7u8c Chain H Binding Site BS01

Receptor Information
>7u8c Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGKSLEWIGR
INPYTGVPSYKHNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYCAREL
GGYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPES
VTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAH
PASSTTVDKKLEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u8c Highly active CAR T cells that bind to a juxtamembrane region of mesothelin and are not blocked by shed mesothelin.
Resolution1.74 Å
Binding residue
(original residue number in PDB)		T30 G31 Y32 Y33 H35 R50 N52 Y54 E99
Binding residue
(residue number reindexed from 1)		T30 G31 Y32 Y33 H35 R50 N52 Y54 E99
External links