Structure of PDB 7u5e Chain H Binding Site BS01

Receptor Information
>7u5e Chain H (length=202) Species: 645 (Aeromonas salmonicida) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRYFFAIRYLSDDVDCGLLAGRCISILHGFRQAHPGIQIGVAFPEWSDRD
LGRSIAFVSTNKSLLERFRERSYFQVMQADNFFALSLVLEVPDTCQNVRF
IRNQNLAKLFVGERRRRLARAKRRAKARGEAFQPHMPDETKVVGVFHSVF
MQSASSGQSYILHIQKHRYERSEDSGYSSYGLASNDLYTGYVPDLGAIFS
TL
Ligand information
>7u5e Chain 1 (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccaagaaaaggacuggaagaaaucauccaaguuggggacuauuuucugcc
guauaggcag
.............................................<<<<<
.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u5e Multiple adaptations underly co-option of a CRISPR surveillance complex for RNA-guided DNA transposition.
Resolution4.03 Å
Binding residue
(original residue number in PDB)		Q107 K111 F113 G115 R119 L121 R123 R127 R131 M139 P140 F153 A157 Y163 H166 S187 D189
Binding residue
(residue number reindexed from 1)		Q104 K108 F110 G112 R116 L118 R120 R124 R128 M136 P137 F150 A154 Y160 H163 S184 D186
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 01:43:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7u5e', asym_id = 'H', bs = 'BS01', title = 'Multiple adaptations underly co-option of a CRIS...illance complex for RNA-guided DNA transposition.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7u5e', asym_id='H', bs='BS01', title='Multiple adaptations underly co-option of a CRIS...illance complex for RNA-guided DNA transposition.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '7u5e', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='7u5e', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>