Structure of PDB 7u0e Chain H Binding Site BS01

Receptor Information
>7u0e Chain H (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGPEVKKPGTSARVSCKASGFTSKNTALQWVRQARGQPLEWMGW
IDISNYITNYAQKFRGRLTITWDLSASMAYMELSSLRSEDTAVYYCAAVG
KDDDVLTGGNKYFDHWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>7u0e Chain C (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0e ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		N31 T32 W50 D52 N59 K101 Y112
Binding residue
(residue number reindexed from 1)		N31 T32 W50 D52 N59 K101 Y112
External links