Structure of PDB 7u0a Chain H Binding Site BS01

Receptor Information
>7u0a Chain H (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGVVQPGRSLRISCAVSGFTFGSYAMHWVRQAPGKGLEWVGV
MSSDGHNEYYADSVKGRFTISRDNSRNKLYLEMNNLRVDDTAVFYCARGS
DYVDDSPPLHYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>7u0a Chain A (length=13) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSKRSFIEDLLFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0a ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		S31 Y32 A33 H35 D54 N57 E58 G99 S100 D101 Y102 V103 P108
Binding residue
(residue number reindexed from 1)		S31 Y32 A33 H35 D54 N57 E58 G99 S100 D101 Y102 V103 P108
External links