Structure of PDB 7st8 Chain H Binding Site BS01

Receptor Information
>7st8 Chain H (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWL
AHIWWDDVKRYNPALKSRLTISKDTSSSQVFLKIASGDTIDTATYYCARI
PTDDYYALDHWGQGASVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLV
KGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSET
VTCNVAHPASSTKVDKKIVPRDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7st8 Monoclonal antibody 7H2.2 binds the C-terminus of the cancer-oocyte antigen SAS1B through the hydrophilic face of a conserved amphipathic helix corresponding to one of only two regions predicted to be ordered
Resolution2.75 Å
Binding residue
(original residue number in PDB)		H50 W52 W53 D54 R58 D98 D99 Y100 Y100A
Binding residue
(residue number reindexed from 1)		H52 W54 W55 D56 R60 D103 D104 Y105 Y106
External links